DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina6

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:393 Identity:111/393 - (28%)
Similarity:194/393 - (49%) Gaps:40/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLSIILLGVWI---------SAPEGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALG 59
            ||  ...|:|.         ::..||..|..|   ||..|:|.|.....|:|.:||||||.:||.
  Rat    11 WL--CTSGLWTAQASTNESSNSHRGLAPTNVD---FAFNLYQRLVALNPDKNTLISPVSISMALA 70

  Fly    60 LAYYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLE--IANKVYTRQNLTVSS 122
            :...|:  .....||.......:.|:..:.:|:..|.:...:|.|.||  :.|.::..|.|.:..
  Rat    71 MVSLGS--AQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKD 133

  Fly   123 HFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKAR 187
            .|....::|::||...:||...|:|.:|||:.||.:|:.|||.|...|:...:..|||.|:.:..
  Rat   134 SFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDLDSPASFILVNYIFLRGI 198

  Fly   188 WARPFNDEDTRDREFWLSESRSIQVPTMF-ADNWYYYAD--YPELDAKAIELFFENINLTMWFIL 249
            |..||:.|:||:.:|:::|:.:::||.|. :.:..|:.|  :|   .:.|::.:.. |.|.:|||
  Rat   199 WELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFP---CQLIQMDYVG-NGTAFFIL 259

  Fly   250 PNQRSGLQALEQKLKGVDFNLLEDRW----QWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSD 310
            |:|..    ::..:..:..:.: |||    ..:.|::|:|||......||:..|..:.|..:.::
  Rat   260 PDQGQ----MDTVIAALSRDTI-DRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTN 319

  Fly   311 AADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII 375
            .:|||...:|.|:  .:|.| ||..:.::|........:   |.|:.|..:|.....:.||..::
  Rat   320 QSDFSGNTKDVPL--TLTMV-HKAMLQLDEGNVLPNSTN---GAPLHLRSEPLDIKFNKPFILLL 378

  Fly   376 RDK 378
            .||
  Rat   379 FDK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 103/360 (29%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 105/365 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.