DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpine2

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_062070.1 Gene:Serpine2 / 29366 RGDID:3748 Length:397 Species:Rattus norvegicus


Alignment Length:424 Identity:118/424 - (27%)
Similarity:190/424 - (44%) Gaps:63/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MN-HWLSIILLGVWISAPEGLGNTIKDRNL---FATELFQTLATDRQDENVIISPVSIQLALGLA 61
            || |:...||..|.:|:.....|::....|   ...::|..:...:..|||:|||..|...||:.
  Rat     1 MNWHFPFFILTTVTLSSVYSQLNSLSLEELGSDTGIQVFNQIIKSQPHENVVISPHGIASILGML 65

  Fly    62 YYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLHSYI--KSKTVLEIANKVYTRQNLTVSSHF 124
            ..||:|||    :|.|....:.:.:|:.:....:..:.:  |:|.::.:||.|:.|....|...|
  Rat    66 QLGADGRT----KKQLSTVMRYNVNGVGKVLKKINKAIVSKKNKDIVTVANAVFVRNGFKVEVPF 126

  Fly   125 REVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPD------TNVALVNAIY 183
            ....::.|..||:.::|.....|.:.||.|||.:|...|:.:   |.|:      |.:.||||:|
  Rat   127 AARNKEVFQCEVQSVNFQDPASACDAINFWVKNETRGMIDNL---LSPNLIDSALTKLVLVNAVY 188

  Fly   184 FKARWARPFNDEDTRDREFWLSESRSIQVP-----TMFADN--------WYYYADYPELDAKAIE 235
            ||..|...|..|:|:.|.|...:.:|.|||     ::|...        ||.:          ||
  Rat   189 FKGLWKSRFQPENTKKRTFVAGDGKSYQVPMLAQLSVFRSGSTKTPNGLWYNF----------IE 243

  Fly   236 LFFENINLTMWFILPNQRS-GLQALEQKLKGVDFNLLEDRWQWQSVSV------YLPKFKFEFDT 293
            |.:...:::|...||.:.| .|.|:...:.....|      .|.:..|      .||||.....|
  Rat   244 LPYHGESISMLIALPTESSTPLSAIIPHISTKTIN------SWMNTMVPKRMQLVLPKFTAVAQT 302

  Fly   294 DLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMS 357
            ||:..|..:||:.||..: |:|:.|.:...:  .::.:..|..|:|:|.|.:||..:.|..:..|
  Rat   303 DLKEPLKALGITEMFEPSKANFAKITRSESL--HVSHILQKAKIEVSEDGTKAAVVTTAILIARS 365

  Fly   358 LPLDPKTFVADHPFAFIIRDK--HAVYFTGHIVK 389
               .|..|:.|.||.|.||..  .|:.|.|.:.|
  Rat   366 ---SPPWFIVDRPFLFCIRHNPTGAILFLGQVNK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 109/392 (28%)
Serpine2NP_062070.1 serpinE2_GDN 21..395 CDD:381039 110/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.