DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinf2

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:375 Identity:105/375 - (28%)
Similarity:177/375 - (47%) Gaps:35/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SAPEGLGNTIKDRNL------FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAEL 73
            |||    .|.:.|.|      |.|:||..:|......|:::||:|:.|||.....||..:|...|
  Rat    72 SAP----TTEETRRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENL 132

  Fly    74 QKTLHASAKESKDGLAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEV 136
            |:.||.:       :.....:||..:.::..  .:.:|.::|.::...:...|.|.::|.|.::.
  Rat   133 QRVLHMN-------MGSCIPHLLSHFCQNLNPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKP 190

  Fly   137 EPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDRE 201
            ..|. .|:.|.:..||:|||:.||.|||..:..|..:|.:.|:|||:|...|...|:...|:...
  Rat   191 VKLT-GRQEEDLMNINKWVKEATEGKIEDFLSELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDS 254

  Fly   202 FWLSESRSIQVPTMFADNW---YYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKL 263
            |.|.|..::.|..|.|.::   ::..:.||:  :.....|:| |::...|:|.. .|....|...
  Rat   255 FHLDEQFTVPVAMMHAQSYPLRWFLLEQPEI--QVAHFPFQN-NMSFVVIMPTY-FGWNVSEVLA 315

  Fly   264 KGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRIT 328
            ......|.:...:.:...|.|||...|...||..||.|:|:..:| .:.|...|...|.:   ::
  Rat   316 NLTWDTLYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLF-QSPDLRGISDQSLV---VS 376

  Fly   329 KVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK 378
            .|||::.::::|.|.|||.|:..|...|||    .:|..:.||.|.|.::
  Rat   377 SVQHQSTMELSEAGVEAAAATSTAMTRMSL----SSFFLNRPFIFFIMEE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 100/362 (28%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 100/361 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.