DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinf1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:403 Identity:96/403 - (23%)
Similarity:179/403 - (44%) Gaps:50/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 APEGLGNTIKDR----------------NLFATELFQTLATDRQDENVIISPVSIQLALGLAYYG 64
            ||:..|..:.:.                :.|..:|::..:......|:::||:|:..||.....|
  Rat    31 APDSTGEPVVEEDDPFFKAPVNKLAAAVSNFGYDLYRLRSGAVSTGNILLSPLSVATALSALSLG 95

  Fly    65 AEGRTAAELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQ 129
            ||.||.:.:.:.|:.....:.| :..:|..||.|....:...:.|:::...:.|.|.|.|     
  Rat    96 AEQRTESVIHRALYYDLINNPD-IHSTYKELLASVTAPEKNFKSASRIVFERKLRVKSSF----- 154

  Fly   130 KYFDSEVEPLDFSRETEA----------VEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYF 184
                  |.||:.|..|..          :::||.||:.|.:.||.|....:....::.|:...||
  Rat   155 ------VAPLEKSYGTRPRILTGNPRIDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYF 213

  Fly   185 KARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYY-YADYPELDAKAIELFFENINLTMWFI 248
            |.:||..|:...|..::|.|.|.|:::||.|....... |....:|:.|..:|.... ::::.|.
  Rat   214 KGQWATKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTG-SMSIIFF 277

  Fly   249 LP-NQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAA 312
            || .....|..:|:.|.....:.::...:.....:.:||.|..::.|:..:|..|.:.::| ::.
  Rat   278 LPLTVTQNLTMIEESLTSEFVHDIDRELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLF-ESP 341

  Fly   313 DFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRD 377
            |||.| ...|:  ::|:|:|:...:.||.|...:.......|.::.|||   :..:.||.|::||
  Rat   342 DFSKI-TGKPV--KLTQVEHRAAFEWNEEGAGTSSNPDLQPVRLTFPLD---YHLNRPFIFVLRD 400

  Fly   378 KH--AVYFTGHIV 388
            ..  |:.|.|.|:
  Rat   401 TDTGALLFIGRIL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 92/372 (25%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 93/394 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.