DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb1b

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:384 Identity:122/384 - (31%)
Similarity:187/384 - (48%) Gaps:63/384 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYH 93
            ||..|||.||.......|:..||.||..:|.:.:.||:|.|||:|.||||..:.|.         
Mouse    10 LFTLELFHTLKESSPTGNIFFSPFSISSSLAMVFLGAKGSTAAQLSKTLHFDSVED--------- 65

  Fly    94 NLLHSYIKSKT----------VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE-A 147
              :||..:|.|          .|::||::|..:.......|....||.:.:::..:||...:| |
Mouse    66 --IHSCFQSLTAEVSKLGASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASEDA 128

  Fly   148 VEQINRWVKQQTENKI-----ERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSES 207
            .::||:|||.|||.||     :.||:|:   |.:.||||||||..|...|...:|.:..|.|::.
Mouse   129 RKEINQWVKGQTEGKIPELLAKGVVDSM---TKLVLVNAIYFKGIWEEQFMTRETINAPFRLNKK 190

  Fly   208 RSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILP----NQRSGLQALEQKLKGVDF 268
            .:..|..|:....:.:....:|..|.:|:.::...|:|..:||    ::.:||:.:|::|     
Mouse   191 DTKTVKMMYQKKKFPFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQL----- 250

  Fly   269 NLLEDRWQWQ--------SVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIG 324
             .|....:|.        .|.|.||:||.|....|...|..:|:..:||.. ||.|.:     .|
Mouse   251 -TLGKLHEWTKHENLRNIDVHVKLPRFKMEESYILNSNLCCLGVQDLFSSGKADLSGM-----SG 309

  Fly   325 TR---ITKVQHKTFIDVNEIGCEAAGASYAAGVPM----SLPLDPKTFVADHPFAFIIR 376
            :|   ::|:.||:|:||||.|.|||.|:  .|:..    .:|...:.|..||||.|.||
Mouse   310 SRDLFVSKIVHKSFVDVNEQGTEAAAAT--GGIIQVLCEKMPTPQEVFTVDHPFLFFIR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 122/384 (32%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 122/384 (32%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.