DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina5

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:376 Identity:98/376 - (26%)
Similarity:184/376 - (48%) Gaps:33/376 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKE-SKDGLAESYH 93
            ||..|::.|.::...:||..||:|:.::||:...||..:|..::...|..|.:: .:|.|.:.:.
Mouse    46 FAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKLHKGFQ 110

  Fly    94 NLLHSYIKSKTVLEIA--NKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            .||..:.:....|:::  :.::....:.:...|....:..:.|:....:|.....|.:|||.:|.
Mouse   111 QLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQINNYVA 175

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY 221
            :||:.||...::.|:....:.:||.|:|||:|...|::.:|...:|.::..|:.|||.|..::.|
Mouse   176 KQTKGKIVDFIKDLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMMNREDGY 240

  Fly   222 -YYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQ-W------Q 278
             ||.| ..:....:.:.::. |....||||:        |.|:|.|:..|.|...: |      :
Mouse   241 SYYLD-QNISCTVVGIPYQG-NAIALFILPS--------EGKMKQVEDGLDERTLRNWLKMFTKR 295

  Fly   279 SVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGC 343
            .:.:|||||..|....|...|.|:||..:|:..||.|.|...:.|  :::::.||:.::|.|.|.
Mouse   296 RLDLYLPKFSIEATYKLENVLPKLGIQDVFTTHADLSGITDHTNI--KLSEMVHKSMMEVEESGT 358

  Fly   344 EAA---GA--SYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHIVK 389
            .||   ||  ::.:..|.||.::     ...||...:.:...:.|.|.:.:
Mouse   359 TAAAITGAIFTFRSARPSSLKIE-----FTRPFLLTLMEDSHILFVGKVTR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 98/372 (26%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 98/376 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.