DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb10

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:393 Identity:113/393 - (28%)
Similarity:197/393 - (50%) Gaps:44/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-ASAKESKDG---- 87
            |.||.|..:.||...:..|:..||..|..:|.:.|.|.:|.|||::.:.|| .|.::.|.|    
  Rat     9 NQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDSE 73

  Fly    88 --------------LAESYHNLLHSYIK--SKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEV 136
                          :...:..|....:|  :..||:|||::|..:.....:.:.|..:.||.:|.
  Rat    74 KKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKTYFGAEP 138

  Fly   137 EPLDFSRETEAV-EQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTR 198
            :.::|...:..: ::||.||..||..||..::  ::::..|.:.||||:|||..|...|:.::|.
  Rat   139 QSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQNTT 203

  Fly   199 DREFWLSE--SRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQ 261
            :|.|.:::  |:.:|:.:|......::.:  ||....::|.::|...::..:||.:..||:.|| 
  Rat   204 ERPFRINKTTSKPVQMMSMKQSLQVFHIE--ELQTIGVQLHYQNREFSLLLLLPEEVEGLKQLE- 265

  Fly   262 KLKGVDFNLLEDRW------QWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQ 319
              :.:.:..| |:|      ....|.:||||||.|...||:..|..||::..|:.. |:|||:..
  Rat   266 --RAITYEKL-DKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTS 327

  Fly   320 DSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVY 382
            :..:  .::.|.||||:::||.|.||| |...:.|...:........|||||.|:||..  :.:.
  Rat   328 ERNL--FLSNVFHKTFLEINEEGTEAA-AGTGSEVNFRIKAPSIELNADHPFLFLIRHNVTNTIL 389

  Fly   383 FTG 385
            |.|
  Rat   390 FYG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 113/393 (29%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 113/393 (29%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.