DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3n

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:353 Identity:118/353 - (33%)
Similarity:186/353 - (52%) Gaps:9/353 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKD-GLAESYH 93
            ||..|::.||....|:||:.||:||..||.:...||:|.:..|:.:.|..:..|:.: .:...:.
  Rat    54 FAFSLYKKLALRNPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGLKFNLTETPETEIHRGFG 118

  Fly    94 NLLHSYIKSKTVLEIA--NKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :||....:.:..::|:  |.::..:.|.|.:.|:|.|:..:.:|....||.:..||.:.||.:|.
  Rat   119 HLLQRLSQPRDEIQISTGNALFIEKRLQVLAEFQEKAKALYQAEAFTADFQQSREAKKLINDYVS 183

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTM-FADNW 220
            :||:.||:.::.:|...|::.|||.||||.:|..||:..||...||:..:.|.::||.| ..|..
  Rat   184 KQTQGKIQGLITNLAKKTSMVLVNYIYFKGKWKVPFDPRDTFQSEFYSGKRRPVKVPMMKLEDLT 248

  Fly   221 YYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSV-SVYL 284
            ..|....||:...:||.:.. |.:..||||:| ..:|.:|..|:.......:|..:...: .:||
  Rat   249 TPYVRDEELNCTVVELKYTG-NASALFILPDQ-GKMQQVEASLQPETLRRWKDSLRPSMIDELYL 311

  Fly   285 PKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGAS 349
            |||....|.:|...|.::||..:||..||.|.|..|..:  .:::|.||..:||.|.|.|||.|:
  Rat   312 PKFSISADYNLEDVLPELGIKEVFSTQADLSGITGDKDL--MVSQVVHKAVLDVAETGTEAAAAT 374

  Fly   350 YAAGVPMSLPLDPKTFVADHPFAFIIRD 377
            ....||||..|||.....|.||..||.|
  Rat   375 GVKFVPMSAKLDPLIIAFDRPFLMIISD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 118/353 (33%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 118/353 (33%)
RCL 367..394 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.