DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3c

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:386 Identity:116/386 - (30%)
Similarity:190/386 - (49%) Gaps:23/386 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EGLGNTIKDRNL------FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKT 76
            :|.|..:....|      |...|::.||....|:||:.||:||..||.:...||:..|..|:.:.
  Rat    34 QGKGRQLHSLTLASINTDFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEG 98

  Fly    77 LHASAKE-SKDGLAESYHNLLHSYIKSKTVLEI--ANKVYTRQNLTVSSHFREVAQKYFDSEVEP 138
            |..:..| :::.:.:.:.:||....:.:...||  .:.::..:...:.|.|:|..:..:.:|...
  Rat    99 LKFNLTEITEEEIHQGFGHLLQRLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFV 163

  Fly   139 LDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFW 203
            .||.:..||.:.||.:|..||:.||..:...|:..|::.|||.:.||.:|..|||..||.:.||:
  Rat   164 ADFKQCNEAKKFINDYVSNQTQGKIAELFSDLDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFY 228

  Fly   204 LSESRSIQVPTM-FADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVD 267
            |.|.||::||.| ..|....|....||....:||.:.. |.:..||||:| ..:|.:|..|:...
  Rat   229 LDEKRSVKVPMMKIKDLTTPYVRDEELSCSVLELKYTG-NASALFILPDQ-GKMQQVESSLQPET 291

  Fly   268 FNLLEDRWQWQSVS-VYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTR---IT 328
            ....:|..:.:.:| :.:|||....|.:|...|.::||..:||..||.|.|     .||:   ::
  Rat   292 LKKWKDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRI-----TGTKNLHVS 351

  Fly   329 KVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKH--AVYFTGHI 387
            :|.||..:||:|.|.|.|.|:.......|||........:.||..:|.|.:  :|:|.|.:
  Rat   352 QVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGKV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 114/374 (30%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 112/366 (31%)
RCL 365..392 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.