DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:418 Identity:122/418 - (29%)
Similarity:205/418 - (49%) Gaps:56/418 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IILLGVWISAPEGLGNTIKD----------------RNL--FATELFQTLATDRQDENVIISPVS 53
            ::|.|:...||..|....::                .||  ||..|::.|.......|:..||:|
  Rat    10 LLLAGLCCLAPSFLAEDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMS 74

  Fly    54 IQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYHNLLHSYIK--SKTVLEIANKVYTR 115
            |..|..:...|::|.|..::.:.|..:..:..:. :.:::|:||.:..:  |:..|...|.::..
  Rat    75 ITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVN 139

  Fly   116 QNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVN 180
            :||.:...|.|..:..:.||...::|:...||.:.||.:|::.|:.||..:::.|:.||..||||
  Rat   140 KNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVN 204

  Fly   181 AIYFKARWARPFNDEDTRDREFWLSESRSIQVPTM------------FADNWYYYADYPELDAKA 233
            .|:||.:|.||||.|.|||.:|.:.:|.:::||.|            ...:|....||..     
  Rat   205 YIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLG----- 264

  Fly   234 IELFFENINLTMWFILPNQRSGLQALEQKL-KGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRP 297
                    |.|..|:||:. ..:|.|||.| |.:....|.:| |.:|..:|.||.......:|:.
  Rat   265 --------NATAIFLLPDD-GKMQHLEQTLTKDLISRFLLNR-QTRSAILYFPKLSISGTYNLKT 319

  Fly   298 TLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDP 362
            .|..:||:.:|::.||.|.|.:|:|:  ::::..||..:.::|.|.|||||:....||||||...
  Rat   320 LLSSLGITRVFNNDADLSGITEDAPL--KLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQV 382

  Fly   363 KTFVADHPFAFII--RDKHAVYFTGHIV 388
            |   .||||.|:|  .:..:..|.|.::
  Rat   383 K---FDHPFIFMIVESETQSPLFVGKVI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 117/378 (31%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 115/376 (31%)
RCL 367..386 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.