DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb10

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:322 Identity:80/322 - (24%)
Similarity:144/322 - (44%) Gaps:53/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LAYYGAEGRTAAELQKTLHASAKESKDGLAES-------------------YHNLLHSYIK--SK 103
            :.|.|.:|.||.::.:.|..|:.|......:|                   :..|....:|  :.
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly   104 TVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAV-EQINRWVKQQTENKIERVV 167
            .||:.||::|..:.....:.:.|..:.||.:|.:.::|...:..: ::||.||..||..||..::
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLL 130

  Fly   168 --ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSE--SRSIQVPTMFADNWYYYADYPE 228
              :|::..|.:.||||:|||..|...|:.:.|.:|.|.:::  |:.:|:.:|......::.:  |
Mouse   131 PDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIE--E 193

  Fly   229 LDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRW------QWQSVSVYLPKF 287
            |....::|.::|.:|::..:||....||:.||   :.:.:..| |:|      ....|.:|||||
Mouse   194 LQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLE---RAITYEKL-DKWTSADMMDTYEVQLYLPKF 254

  Fly   288 KFEFDTDLRPTLHKMGISAMFSD-----------AADFSNIFQDSPIGTRIT----KVQHKT 334
            |.|...||:..|.....|..:|.           :|...|.....|:..|..    |.:|.|
Mouse   255 KMEESYDLKSALRGQKFSGPYSKENNEDHLPHIYSATLDNQQNGHPVSPRHVFGNGKRKHST 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 80/322 (25%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 72/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.