DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb13

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:384 Identity:113/384 - (29%)
Similarity:187/384 - (48%) Gaps:38/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHA----------SAKES 84
            |..:||:.| ....|.||..|||.|..|:|:...|..|.||:||||.|:.          |.:|.
Mouse    11 FLFDLFKEL-NKTNDGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEEE 74

  Fly    85 KDGLAESYHNLLH-----SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDF-SR 143
            .:...|.:|.|..     |...:...|.|:|:::..:.......:.:..:||:.:.:||:|| :.
Mouse    75 IEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHASLEPVDFVNA 139

  Fly   144 ETEAVEQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSE 206
            ..|:.::||.||:.||..|::.:..  ||...|.:.|:|.:|||..|.|.|..|.|::.:|||::
Mouse   140 ADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWLNK 204

  Fly   207 SRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLL 271
            :.|..|..|...:.:.:....:|.||.:.:.::|.:::|:.:|||...||:.:..|:..      
Mouse   205 NLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSP------ 263

  Fly   272 EDRWQWQS--------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRIT 328
            |...:|.|        |.:.||:.:.|...||.|.|..:||.:.||:.||:|.:...|  |....
Mouse   264 EKLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSARS--GLHAQ 326

  Fly   329 KVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII--RDKHAVYFTG 385
            ...|::|:.|.|.|.||. |....|:.:|.....:....:|||.|.|  |:..::.|.|
Mouse   327 NFLHRSFLVVTEEGVEAT-AGTGVGLKVSSAASCELVHCNHPFLFFIRHRESDSILFFG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 113/384 (29%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 113/384 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.