DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3j

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:381 Identity:96/381 - (25%)
Similarity:174/381 - (45%) Gaps:43/381 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            ||..|::.||.....:|.:.||:||.:||.....||:|.|..|:.:.|..:..|:.:. :.:.:.
Mouse    54 FAFSLYKKLALKNPHKNFVFSPLSITIALASLSLGAKGNTLEEILEGLKFNLTETPEADIHQGFG 118

  Fly    94 NLLHSYIKSKTVLEIA--NKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :||....:....::|:  |.:...::|.:.:.|:|.|:..:.:||...||.:..||.:.:|.:|.
Mouse   119 HLLQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREARKLLNDYVS 183

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDT------RDR----EFWLSESRSIQ 211
            .||:..|:.:|..||..|::.:.|...|..:|...|:..:|      .||    :..:.:.:.::
Mouse   184 NQTQGMIKELVSDLEERTSMVMTNFALFNGKWNMTFDPYETFMGTFIEDRRTPVKVSMMKMKELR 248

  Fly   212 VPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQ 276
            .|        |:.| .::....:||.::.....| ||||:|        .|:|.|:.:|.....:
Mouse   249 AP--------YFRD-EKMKCTVVELNYKGNGKAM-FILPDQ--------GKMKQVEASLQPATLR 295

  Fly   277 -WQSV-------SVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHK 333
             |:..       .:|||||....:..|...|.::||..:||..||.|.|.....:  |::::.|.
Mouse   296 GWRKSLRPRMIDELYLPKFSISKNYRLENILPELGIKEVFSTQADLSGISGGKDV--RVSRMFHS 358

  Fly   334 TFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII--RDKHAVYFTGHI 387
            ..:|:.|.|.||...:......:|...:|.....:.||.|.:  .|...:.|.|.|
Mouse   359 AALDMTETGTEARATTRDKYDFLSTKSNPTVVNLNTPFLFCVLHSDSENIDFMGKI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 95/379 (25%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 96/381 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.