DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb9d

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_035590.1 Gene:Serpinb9d / 20726 MGIID:894667 Length:377 Species:Mus musculus


Alignment Length:392 Identity:116/392 - (29%)
Similarity:195/392 - (49%) Gaps:49/392 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NTIKDRN-LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESK 85
            ||:...| .||..|.:.|..|...|||..||:||..||.:...||:|.|..::.:.||.:..|. 
Mouse     2 NTLSQANGTFAIHLLKVLCQDNPSENVCFSPMSISSALAMVLLGAKGNTVTQICQALHLNPDED- 65

  Fly    86 DGLAESYHNLLHSYIK---SKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEA 147
              :.:.:..|||:..|   .|..|.:||:::......:...|:|...|::.||:|.|.|:...|.
Mouse    66 --VHQGFQLLLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEE 128

  Fly   148 VEQ-INRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRS 209
            ..| ||.||.:||..||..::  :|::..|.:.|.||:||:..|.:.|..:.|::..|.:::..:
Mouse   129 SRQHINMWVSKQTNGKIPDLLPKDSIDSQTRLILANALYFQGTWYKLFEKDSTKEMPFKINKKET 193

  Fly   210 IQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDR 274
            ..|..|:.::.:|:|...|:.|:.:.:.:|.|:|:...:||:            ||||.:.:|:.
Mouse   194 RPVQMMWQEDRFYHAYVKEIQAQVLVMPYEGIDLSFVVLLPD------------KGVDISKVENN 246

  Fly   275 WQWQSVS--------------VYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIG 324
            ..::.::              ||||||:.:.|.|:...|..:||..:|..: ||.|.      :.
Mouse   247 LTFEKLTAWTKPDFMNGIELHVYLPKFQLQEDYDMNSLLQHLGILDVFDGSKADLSG------MS 305

  Fly   325 TR----ITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYF 383
            |:    ::...||..::|||.|.|||.|:....:...|...|:||.|||||.|.|...  :::.|
Mouse   306 TKENLCLSNFVHKCVVEVNEEGTEAAAATAGKTIQCCLGSYPQTFCADHPFLFFIMHSTTNSILF 370

  Fly   384 TG 385
            .|
Mouse   371 CG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 114/386 (30%)
Serpinb9dNP_035590.1 serpin 1..377 CDD:393296 116/392 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.