DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb5

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001347782.1 Gene:Serpinb5 / 20724 MGIID:109579 Length:375 Species:Mus musculus


Alignment Length:377 Identity:107/377 - (28%)
Similarity:193/377 - (51%) Gaps:41/377 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-ASAKESKDGL--AES 91
            ||.:||:.|.......|::.||:.:..:|.||..|.:|.||.|:.:.|| .:.|:...|.  ..|
Mouse    11 FAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHFENVKDVPFGFQTVTS 75

  Fly    92 YHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE-QINRWV 155
            ..|.|.|:..    |::..::|..::|..|:.|....::.:..|:|.:||..:.|..: |||..:
Mouse    76 DVNKLSSFYS----LKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVDFKDKLEETKGQINSSI 136

  Fly   156 KQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFAD 218
            |:.|:...|.::  .|:...|.:.:|||.||..:|.:.|.:.:|::..|.:|::.:..|..|..:
Mouse   137 KELTDGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRISKTDTKPVQMMNLE 201

  Fly   219 NWYYYADYPELDAKAIELFFENINLTMWFILP----NQRSGLQALEQKLKGVDFNLLEDRWQWQS 279
            ..:...:..::..|.|||.|:|.:|:|..:||    ::.:||:.:||:|..      |...||.:
Mouse   202 ATFCLGNIDDISCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEQQLNP------ETLLQWTN 260

  Fly   280 --------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRITKVQHKTF 335
                    |.:.|||||.|...|.:.:|..:|:.::|::: :|||.:.:..  |..::.|.|:..
Mouse   261 PSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETK--GVSLSNVIHRVC 323

  Fly   336 IDVNEIGCEAAGASYAAGVPMSLPLDPK-TFVADHPFAFIIR---DKHAVYF 383
            :::.|.|.|      :..||.|..|..| .|.|||||.:|||   .::.::|
Mouse   324 LEITEDGGE------SIEVPGSRILQHKDEFNADHPFIYIIRHNKTRNIIFF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 107/377 (28%)
Serpinb5NP_001347782.1 maspin_like 4..375 CDD:239012 107/377 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.