DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb6a

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:389 Identity:129/389 - (33%)
Similarity:211/389 - (54%) Gaps:24/389 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SAPEGLGNTIKD-----RNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQ 74
            :.|.|...||.|     ...||..|.:.|..| ..:||.:||:||..||.:.:.||:|.||:::.
Mouse    12 AGPRGYRLTIMDPLQEANGTFALNLLKILGED-SSKNVFLSPMSISSALAMVFMGAKGTTASQMA 75

  Fly    75 KTLHASAKESKDG---LAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDS 134
            :.| |..|.|.:|   :.:.:.:||....|:.|  :|..||:::..:...:.:.|::...|::::
Mouse    76 QAL-ALDKCSGNGGGDVHQGFQSLLTEVNKTGTQYLLRTANRLFGDKTCDLLASFKDSCLKFYEA 139

  Fly   135 EVEPLDFSRETEAVEQ-INRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDED 196
            |:|.|||...||...| ||.||.::||:||:.|:.  ::..||::.||||||||..|.:.||.|.
Mouse   140 ELEELDFQGATEESRQHINTWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEH 204

  Fly   197 TRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQ 261
            ||:..|.:|::....|..||..:.:......|:..|.:.|.:.:..|.|..:||::...|..:|:
Mouse   205 TREMPFKVSKNEEKPVQMMFKKSTFKMTYIGEIFTKILLLPYVSSELNMIIMLPDEHVELSTVEK 269

  Fly   262 KL---KGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPI 323
            ::   |.:::..| |:...:.|.|:|||||.|.:.::...|:|:|::..|...||||.:  .|..
Mouse   270 EVTYEKFIEWTRL-DKMDEEEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRADFSGM--SSKQ 331

  Fly   324 GTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIR--DKHAVYFTG 385
            |..::||.||.|::|||.|.|||.|:........:...|: |.|||||.|.|.  ..:.:.|.|
Mouse   332 GLFLSKVVHKAFVEVNEEGTEAAAATAGMMTVRCMRFTPR-FCADHPFLFFIHHVKTNGILFCG 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 124/371 (33%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 124/376 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.