DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3m

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:368 Identity:116/368 - (31%)
Similarity:187/368 - (50%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            ||..|::.:|....|:|::.||:||..||.|...||:|.|..|:.:.|..:..|:.:. :.:.:.
Mouse    54 FAFSLYKKMALKNPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETSEADIHQGFG 118

  Fly    94 NLLH--SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :||.  |..:.:..:.|.|.::..::|.:.:.|.|..:..:.:|....||.:.|||.:.||.:|.
Mouse   119 HLLQRLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEATKLINDYVS 183

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTM------ 215
            .||:..|::::..|:..|.:.|||.||||.:|...|:.:||.:.||:|.|.||::||.|      
Mouse   184 NQTQGMIKKLISELDDRTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMKMKFLT 248

  Fly   216 ---FADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQW 277
               |.|.        ||....:||.:.. |.:..||||:| ..:|.:|..|:.....    :| |
Mouse   249 TRHFRDE--------ELSCSVLELKYTG-NASALFILPDQ-GRMQQVEASLQPETLR----KW-W 298

  Fly   278 QSV------SVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTR---ITKVQHK 333
            :|:      .:|||||....|.:|:..|.::||..:||..||.|.|     .||:   :::|.||
Mouse   299 KSLKTRKIGELYLPKFSISTDYNLKDILPELGIKEIFSKQADLSGI-----TGTKDLSVSQVVHK 358

  Fly   334 TFIDVNEIGCEAAGAS-YAAGVPMSLPLDPKTFVADHPFAFII 375
            ..:||.|.|.|||.|: :..|. .|..|...|...:.||..:|
Mouse   359 AVLDVAETGTEAAAATGFIFGF-RSRRLQTMTVQFNRPFLMVI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 116/368 (32%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 114/366 (31%)
RCL 367..392 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.