DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina3g

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:378 Identity:119/378 - (31%)
Similarity:181/378 - (47%) Gaps:38/378 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKD-GLAESYH 93
            ||..|::.|.....||||:.||.||..||.|...||:..|..|:.:.|..:..|:.: .:.:.:.
Mouse    44 FAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFR 108

  Fly    94 NLLH--SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            .||.  |...::..:...:.::..::|.:.:.|:|.|:..:.:|....||.:..:|.:.||.:|.
Mouse   109 YLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLKATKLINDYVS 173

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY 221
            ..|:.||::::..|:....:.|||.||||.:|..||:..||...||:|.|.||:.|..|  ...|
Mouse   174 NHTQGKIKQLISGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKRSVIVSMM--KTGY 236

  Fly   222 ----YYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSV-- 280
                |:.| .||....:||.:.. |.:..||||:| ..:|.:|..|:.      |...:|::.  
Mouse   237 LTTPYFRD-EELSCTVVELKYTG-NASAMFILPDQ-GRMQQVEASLQP------ETLRKWKNSLK 292

  Fly   281 -----SVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGT---RITKVQHKTFID 337
                 .:.||||....|..|...|.::||..:||..||.|.|     .||   |:::|.||..:|
Mouse   293 PRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAI-----TGTKDLRVSQVVHKAVLD 352

  Fly   338 VNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHIVKF 390
            |.|.|.|||.|:..|||......|......:.||..||.|..|     ||..|
Mouse   353 VAEKGTEAAAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTKA-----HIALF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 116/373 (31%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 117/376 (31%)
RCL 357..382 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.