DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb9c

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:378 Identity:106/378 - (28%)
Similarity:180/378 - (47%) Gaps:22/378 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NTIKDRN-LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESK 85
            |.:.:.| .||..|.:.|..:...:||..||::|..||.:...|.:|.|..::.:   |....:.
Mouse    29 NIVYEANGTFAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISE---AIGLNTA 90

  Fly    86 DGLAESYHNLLHSYIK--SKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSR-ETEA 147
            ..:.:|:..:|:...|  .|....:||:::..........|:|...:::..|:|.|.|:: ..||
Mouse    91 IDIHQSFLWILNILKKPTRKYTFRMANRLFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEA 155

  Fly   148 VEQINRWVKQQTENKIERVVE--SLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSI 210
            ...||.||.:.|:.||..::.  |::.:|.:.||||:|||.||...|:.:.||...|.:::....
Mouse   156 RNHINTWVCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEER 220

  Fly   211 QVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLE--- 272
            .|..||.::.:..|...|:..:.:.|.::...|::..:||:....|..:|..|   .|..|.   
Mouse   221 PVQMMFQEDMFKLAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNL---TFEKLSAWT 282

  Fly   273 --DRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTRITKVQHKT 334
              |..:...|.|:|||||.|...|:......:|:..:|... ||.|.:..:.  |..::|...|.
Mouse   283 KPDYLKTTKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGKADLSEMSPER--GLCVSKFIQKC 345

  Fly   335 FIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTG 385
            .::|||.|.||..|:....|..:...|.:||.|||||.|.||..  :::.|.|
Mouse   346 VVEVNEEGTEATAATADDTVCSAETHDGQTFCADHPFLFFIRHNKTNSILFCG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 105/372 (28%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 106/378 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.