DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb9b

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:388 Identity:124/388 - (31%)
Similarity:202/388 - (52%) Gaps:41/388 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NTIKDRN-LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESK 85
            :|:.:.| .||..|.:.|......:||..|||||..||.:...||:.:||.::.:.|  ..|:.|
Mouse     2 STLSEANGTFAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQAL--GLKKEK 64

  Fly    86 DGLAESYHNLLHSYIK--SKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSR-ETEA 147
             |:.:.:..||....|  .|..|.:||:::..:...|...|:|...:::|||:|.::|.: ..|:
Mouse    65 -GIHQGFLKLLRKLNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVES 128

  Fly   148 VEQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSI 210
            .:.||.||.:|||.||..::  :|:...|.:.||||:|||..||..|..|.||:..|::::....
Mouse   129 RQCINTWVSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKR 193

  Fly   211 QVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED-- 273
            .|..|...:.:.:|...||.|:.:.:.:|.:.|::..:||.            ||||.:.:|:  
Mouse   194 PVQMMCQTDTFMFAFVDELPARLLIMPYEGMELSLMVLLPE------------KGVDLSKVENDL 246

  Fly   274 ------RW-----QWQS-VSVYLPKFKFEFDTDLRPTLHKMGISAMF-SDAADFSNIFQDSPIGT 325
                  .|     .|.: |.|:|||||.:.|.:::..|..:||..:| .:.||.|.:..:..:  
Mouse   247 TFEKLIAWTKPDIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAMSPERNL-- 309

  Fly   326 RITKVQHKTFIDVNEIGCEAAGASYAAG-VPMSLPLDPKTFVADHPFAFIIR--DKHAVYFTG 385
            .::|..||:.::|||.|.|||.||.|.| :|:.|...|..|.|||||.|.||  ..:::.|.|
Mouse   310 CLSKFIHKSVVEVNEEGTEAAAASSAEGIIPLCLGGGPSWFCADHPFLFFIRHNQTNSILFCG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 123/382 (32%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 123/386 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.