DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpina1e

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:422 Identity:112/422 - (26%)
Similarity:203/422 - (48%) Gaps:57/422 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLSIILLGVWISAPEGLGNTI-------KDR---------NL--FATELFQTLATDRQDENVIIS 50
            |..::|.|:....|..|...:       ||:         ||  ||..|::.|.......|:..|
Mouse     7 WCLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFS 71

  Fly    51 PVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYHNLLHSYIKSKTVLEIA--NKV 112
            ||||..|..:...|::|.|..::.:.|..:..::.:. :..|:.:||.:..:..:.|:::  |.:
Mouse    72 PVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHNSFQHLLQTLNRPDSELQLSTGNGL 136

  Fly   113 YTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVA 177
            :...:|.:...|.|.|:.::.:||..::|:...||.:.||.:|::.|:.||...|:.||.||...
Mouse   137 FVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIVEAVKKLEQDTVFV 201

  Fly   178 LVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTM------------FADNWYYYADYPELD 230
            |.|.|.||.:|.:||:.|:|:..||.:.||.:::||.|            ...:|....||..  
Mouse   202 LANYILFKGKWKKPFDPENTKQAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAG-- 264

  Fly   231 AKAIELFFENINLTMWFILPNQRSGLQALEQKL-KGVDFNLLEDRWQWQSVSVYLPKFKFEFDTD 294
                       |.|..|:||:. ..:|.|||.| |.:....|.:| :.:...:::|:.....:.:
Mouse   265 -----------NATAVFLLPDD-GKMQHLEQTLNKELISKFLLNR-RRRLAQIHIPRLSISGNYN 316

  Fly   295 LRPTLHKMGISAMFSDAADFSNIFQD-SPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSL 358
            |...:..:||:.:|:..||.|.|.:: :|:  ::::..||..:.::|.|.|||.|:...|..:|:
Mouse   317 LETLMSPLGITRIFNSGADLSGITEENAPL--KLSQAVHKAVLTIDETGTEAAAATVLQGGFLSM 379

  Fly   359 PLDPKTFVADHPFAFIIRDKH--AVYFTGHIV 388
               |.....:.||.|||.::|  :..|.|.:|
Mouse   380 ---PPILHFNRPFLFIIFEEHSQSPLFVGKVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 104/379 (27%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 101/376 (27%)
RCL 368..387 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.