DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinf1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus


Alignment Length:376 Identity:99/376 - (26%)
Similarity:178/376 - (47%) Gaps:40/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDGLAESYHN 94
            |..:|::..::.....||::||:|:..||.....|||.||.:.:.:.|:.....:.| :..:|..
Mouse    60 FGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPD-IHSTYKE 123

  Fly    95 LLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEA----------VE 149
            ||.|....:..|:.|:::...:.|.|.|.|           |.||:.|..|..          ::
Mouse   124 LLASVTAPEKNLKSASRIVFERKLRVKSSF-----------VAPLEKSYGTRPRILTGNPRVDLQ 177

  Fly   150 QINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPT 214
            :||.||:.|.:.||.|....:....::.|:...|||.:|...|:...|..::|.|.|.|:::||.
Mouse   178 EINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPM 242

  Fly   215 MFADNWYY-YADYPELDAKAIELFFENINLTMWFILP-NQRSGLQALEQKLKGVDFNLLEDRWQW 277
            |....... |....:|:.|..:|.... ::::.|.|| .....|..:|:.|.....:.::...:.
Mouse   243 MSDPKAILRYGLDSDLNCKIAQLPLTG-SMSIIFFLPLTVTQNLTMIEESLTSEFIHDIDRELKT 306

  Fly   278 QSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIG 342
            ....:.:||.|..|:.:|..:|..|.:.::| ::.|||.| ...|:  ::|:|:|:...:.||  
Mouse   307 IQAVLTVPKLKLSFEGELTKSLQDMKLQSLF-ESPDFSKI-TGKPV--KLTQVEHRAAFEWNE-- 365

  Fly   343 CEAAGASYAAG---VPMSLPLDPKTFVADHPFAFIIRDKH--AVYFTGHIV 388
             |.||:|.:.|   |.::.|||   :..:.||.|::||..  |:.|.|.|:
Mouse   366 -EGAGSSPSPGLQPVRLTFPLD---YHLNQPFLFVLRDTDTGALLFIGRIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 98/373 (26%)
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 99/376 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.