| Sequence 1: | NP_524805.1 | Gene: | Spn43Aa / 45041 | FlyBaseID: | FBgn0024294 | Length: | 390 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_109591.1 | Gene: | SERPINB1 / 1992 | HGNCID: | 3311 | Length: | 379 | Species: | Homo sapiens |
| Alignment Length: | 31 | Identity: | 10/31 - (32%) |
|---|---|---|---|
| Similarity: | 16/31 - (51%) | Gaps: | 1/31 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 TTSLLHLARGMYNRCHRLIIPRNIHSTVQLL 34 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Spn43Aa | NP_524805.1 | serpin42Dd-like_insects | 27..390 | CDD:381070 | 3/8 (38%) |
| SERPINB1 | NP_109591.1 | serpinB1_LEI | 1..379 | CDD:381028 | 10/31 (32%) |
| CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 | 351..379 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||