DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and SERPINB1

DIOPT Version :10

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:31 Identity:10/31 - (32%)
Similarity:16/31 - (51%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTSLLHLARGMYNRCHRLIIPRNIHSTVQLL 34
            |.|::.|..|:..:| |....|...:|:.||
Human    71 TFSIVALGIGIRIQC-REAESRRSQNTIVLL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 serpin42Dd-like_insects 27..390 CDD:381070 3/8 (38%)
SERPINB1NP_109591.1 serpinB1_LEI 1..379 CDD:381028 10/31 (32%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.