DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinf2

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:357 Identity:97/357 - (27%)
Similarity:169/357 - (47%) Gaps:33/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            |.|:||..:|......|:::||:|:.|||.....||:.:|...|.:.||.:....... |:..|.
Mouse    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQ 153

  Fly    94 NLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQ 158
            ||      ....:.:|.::|.::...:...|.|.:::.|.::...|. .::.|.:..||:|||:.
Mouse   154 NL------GPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLT-GKQEEDLANINQWVKEA 211

  Fly   159 TENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNW--- 220
            ||.|||..:..|...|.:.|:|||:|...|...|:...|:...|.|.|..::.|..|.|.::   
Mouse   212 TEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLR 276

  Fly   221 YYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED-----RWQWQSV 280
            ::..:.||:  :.....|:| |::...::|..      .|..:..|..||..|     ..|.:..
Mouse   277 WFLLEQPEI--QVAHFPFKN-NMSFVVVMPTY------FEWNVSEVLANLTWDTLYHPSLQERPT 332

  Fly   281 SVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEA 345
            .|:|||...:...||..||.::|:..:| ...|...|.:.:.:   ::.|||::.::::|.|.||
Mouse   333 KVWLPKLHLQQQLDLVATLSQLGLQELF-QGPDLRGISEQNLV---VSSVQHQSTMELSEAGVEA 393

  Fly   346 AGASYAAGVPMSLPLDPKTFVADHPFAFIIRD 377
            |.|:..|...|||    .:|..:.||.|.|.:
Mouse   394 AAATSVAMNRMSL----SSFTVNRPFLFFIME 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 97/357 (27%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 97/357 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.