DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and srp-7

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001122924.1 Gene:srp-7 / 179195 WormBaseID:WBGene00005648 Length:373 Species:Caenorhabditis elegans


Alignment Length:378 Identity:107/378 - (28%)
Similarity:182/378 - (48%) Gaps:34/378 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKE 83
            ||| .::.:|:              .|::..||:||.|||.|.:..|:|.|..::::.|   .|.
 Worm    19 GLG-LLRQQNI--------------SESLAFSPLSIALALSLVHVAAKGETRDQIREAL---VKG 65

  Fly    84 SKD-GLAESYHNLLHSYIKSK--TVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRET 145
            |.| .|.:.:.|:..:.:.::  |.:::||.|:||....:...:.:..:|.:::....|||..:.
 Worm    66 STDEQLEQHFANISAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFDNKE 130

  Fly   146 EAVEQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESR 208
            ...|.||.:|::.|.:.|::::  :|:..|....|.||:||||.|...|..:.|...||:.|...
 Worm   131 ATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFKKDSTFKSEFFSSADS 195

  Fly   209 SIQVPTMFADNWYYYADYPELDA-KAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLE 272
            ..::..:.|.:  ...||.|.|. :.:.|.:::....:...||..|.||....:.|.......|.
 Worm   196 KREIDFLHASS--VSRDYAENDQFQVLSLPYKDNTFALTIFLPKTRFGLTESLKTLDSATIQHLL 258

  Fly   273 DRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFID 337
            ......||:|.:||:|.|....|...|..:||...|.:.||..|:..    |..::||.||..|:
 Worm   259 SNVSSTSVNVQIPKWKIETKLGLEEALQSLGIKKAFDNDADLGNMAD----GLYVSKVTHKALIE 319

  Fly   338 VNEIGCEAAGA---SYAAGVPMSLPLDPKTFVADHPFAFII-RDKHAVYFTGH 386
            |:|.|.:||.|   |.:....|.:..:||.|.|||||.|:: :|.|.::...|
 Worm   320 VDEEGTKAAAATTVSISLKSAMFVMEEPKDFTADHPFFFVLSKDNHPLFVGLH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 104/369 (28%)
srp-7NP_001122924.1 serpinL_nematode 14..372 CDD:381047 106/376 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm4841
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.