DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and srp-1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_503315.1 Gene:srp-1 / 178585 WormBaseID:WBGene00005642 Length:366 Species:Caenorhabditis elegans


Alignment Length:364 Identity:101/364 - (27%)
Similarity:187/364 - (51%) Gaps:28/364 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKT-LHASAKESKDGLAESYH 93
            |..:|...|.:| |....:.|||||.|:|.|.:.||:|.|..:::.: ::.|..|.........:
 Worm    15 FGIKLLSDLTSD-QLTPCVFSPVSILLSLALVHLGAKGHTRHDIRNSVVNGSTDEQFIEHFSFIN 78

  Fly    94 NLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQ 158
            .||:|.:.....| |||:::......:...|.:..::::::|...:||.:..||.:.:|:::.:.
 Worm    79 KLLNSSVNDVETL-IANRLFVSPEQAIRKAFTDELREHYNAETATIDFKKSQEAAKIMNQFISES 142

  Fly   159 TENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY 221
            |:.||..::  ::|: |.:..|:|||:|:..|.|.|.  :..:..|.:|.:.:..||.:.....|
 Worm   143 TKGKIPDMIKPDNLK-DVDAILINAIFFQGDWRRKFG--EPAESNFSISATENRLVPMLRETRDY 204

  Fly   222 YYADYPELDAKAIELFFENINLTMWF--ILPNQRSGLQALEQKLKGVD----FNLLEDRWQWQSV 280
            :|....|.  :.|.:.|:  :.:.||  .||.:|.   ||.:.||.::    .||:.:.:| :.:
 Worm   205 FYNKDDEW--QVIGIPFK--DKSAWFAIFLPTRRF---ALAENLKSLNAAKFHNLINNVYQ-EYI 261

  Fly   281 SVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEA 345
            .:..||||.::..:|:..|.|.|::.:|::.||.|.|   .| |.::....|:..|:|:::|..|
 Worm   262 FLTFPKFKMDYKINLKTALAKFGLAELFTEQADLSGI---GP-GLQLASATHQALIEVDQVGTRA 322

  Fly   346 AGASYAAGVPMSLPLD-PKTFVADHPFAF-IIRDKHAVY 382
            |.|:.|.....|...| |.....||||.| ||:|...::
 Worm   323 AAATEAKIFFTSASSDEPLHIRVDHPFLFAIIKDNSPLF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 101/364 (28%)
srp-1NP_503315.1 serpinL_nematode 11..365 CDD:381047 101/364 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm4841
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.