DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpind1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus


Alignment Length:375 Identity:100/375 - (26%)
Similarity:177/375 - (47%) Gaps:31/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTL---ATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH------ASAKESK 85
            ||..|::.|   ||  ..:|:.|:||.|..|:|:...|..|.|..|:...||      ||:|...
Mouse   112 FAFNLYRVLKDQAT--TSDNLFIAPVGISTAMGMISLGLRGETHEEVHSVLHFRDFVNASSKYEV 174

  Fly    86 DGLAESYHNLLHSYIKSK--TVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAV 148
            ..:...:..|.|...:..  ..|...|.:|.::...:...|:...::::.:|.:..:|. :...:
Mouse   175 TTIHNLFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAAMREFYFAEAQEANFP-DPAFI 238

  Fly   149 EQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVP 213
            .:.|..:.:.|:..|:..:|:::|.|.:.::|.||||..|...|..|.|.:..|.|:|...::|.
Mouse   239 SKANNHILKLTKGLIKEALENIDPATQMLILNCIYFKGTWVNKFPVEMTHNHNFRLNEREVVKVS 303

  Fly   214 TMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQ 278
            .|.....:..|:..|||...::|.:.. .::|..::|.:.||::.||.:|.    ..:.:|||..
Mouse   304 MMQTKGNFLAANDQELDCDILQLEYVG-GISMLIVVPRKLSGMKTLEAQLT----PQVVERWQKS 363

  Fly   279 SVS----VYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVN 339
            ..:    |.|||||.|.:.:|...|..|||:.:|:...:.|.| .|..|...:.|  |::.|.||
Mouse   364 MTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI-SDQRIAIDLFK--HQSTITVN 425

  Fly   340 EIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKH--AVYFTGHI 387
            |.|.:||..:....:|:|..:   .|..|.||.|::.:..  .:.|.|.:
Mouse   426 EEGTQAAAVTTVGFMPLSTQV---RFTVDRPFLFLVYEHRTSCLLFMGKV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 100/373 (27%)
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 100/375 (27%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.