DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinh1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:383 Identity:95/383 - (24%)
Similarity:186/383 - (48%) Gaps:32/383 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TIKDRNL-FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKD 86
            |:.:|:. .|..|:|.:|.|:..||:::||:.:..:|||...|.:..||::.:..|  ||::.:|
Mouse    41 TLAERSTGLAFSLYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVL--SAEKLRD 103

  Fly    87 -----GLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETE 146
                 ||.|...:|.:|..::.| .::.:::|...:::.:..|...::::::.|...::|..:..
Mouse   104 EEVHTGLGELLRSLSNSTARNVT-WKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRS 167

  Fly   147 AVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQ 211
            |::.||.|..|.|:.|:..|.:.:|......||||::||..|...|:.:...:|.|.::.|.::.
Mouse   168 ALQSINEWASQTTDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVG 232

  Fly   212 VPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQ 276
            |..|.....|.|.|..:...:.:|:...:...::..::|:....|:.||:.|..........:.|
Mouse   233 VTMMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQ 297

  Fly   277 WQSVSVYLPKFKFEFDTDLRPTLHKMGIS-AMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNE 340
            .::|::.|||...|...||:..|..:|:: |:..:.||.|.:.....:  .:..|.|.|..:.: 
Mouse   298 KKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDL--YLASVFHATAFEWD- 359

  Fly   341 IGCEAAGASYAAGVPMSLPL-------DPKTFVADHPFAFIIRDKH--AVYFTGHIVK 389
                      ..|.|....:       .||.|.|||||.|::||..  ::.|.|.:|:
Mouse   360 ----------TEGNPFDQDIYGREELRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 92/374 (25%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 95/383 (25%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.