DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serping1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:395 Identity:96/395 - (24%)
Similarity:174/395 - (44%) Gaps:59/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SAPEGLGNTIKDRNLFATELFQTL-ATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH 78
            |:...|...:.|   |:.:|:... ||.....|:..||.||...|.....||...|.:.|:..| 
Mouse   142 SSEAKLSEALTD---FSVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGAGDSTKSNLESIL- 202

  Fly    79 ASAKESKDGLAESY-------HNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEV 136
                        ||       |..|..: .||.|..: ::::...:|.:...:...:|..:.|  
Mouse   203 ------------SYPKDFACVHQALKGF-SSKGVTSV-SQIFHSPDLAIRDTYVNASQSLYGS-- 251

  Fly   137 EPLDFSRETEA-VEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDR 200
            .|.....::.| :|.||.||.:.|.:||.::::||..||.:.|:||:|..|:|...|..:.....
Mouse   252 SPRVLGPDSAANLELINTWVAENTNHKIRKLLDSLPSDTCLVLLNAVYLSAKWKITFEPKKMMAP 316

  Fly   201 EFWLSESRSIQVPTMFADNWYYYADYPE--LDAKAIELFFENINLTMWFILP-NQRSGLQALEQK 262
            .|:  ::..|:|| |.:...|..|.:.:  |.||..:|...: ||:...::| ..:..|:.:|:.
Mouse   317 FFY--KNSMIKVP-MMSSVKYPVAQFDDHTLKAKVGQLQLSH-NLSFVIVVPVFPKHQLKDVEKA 377

  Fly   263 LKGVDFNLLEDRWQWQSVSVYLPKF------KFEFDTDLRPTLHKMGISAMFSDAADFS--NIFQ 319
            |....|..:..:.:   :|.:||.:      |.:...|:...:.|:   ..|....|.:  .:.:
Mouse   378 LNPTVFKAIMKKLE---LSKFLPTYLTMPHIKVKSSQDMLSVMEKL---EFFDFTYDLNLCGLTE 436

  Fly   320 DSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVY-- 382
            |..:  :::.::|:|.:::.|.|.|||.|| |.....|||:    |....||.|::.|:...:  
Mouse   437 DPDL--QVSAMKHETVLELTESGVEAAAAS-AISFGRSLPI----FEVQRPFLFLLWDQQHRFPV 494

  Fly   383 FTGHI 387
            |.|.:
Mouse   495 FMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 93/380 (24%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141
serpinG1_C1-INH 141..500 CDD:381006 96/395 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.