DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and Serpinb7

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:378 Identity:113/378 - (29%)
Similarity:184/378 - (48%) Gaps:31/378 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLH-------ASAKESKDG 87
            |..:||:.:.:.:.:.||..|.:||..||.|...||.|..|.::.|.||       .::..|:.|
  Rat    11 FGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNSSNSQLG 75

  Fly    88 LAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVE- 149
            |......:|.....|..  .|.|||.|:..:.......:.|.|:..::::||.:||:.:.:... 
  Rat    76 LQYQLKRVLADINSSHKDYELSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTNDIQETRF 140

  Fly   150 QINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQV 212
            :||:|::.:|..||::|:  .||.....:.||||:|||.:|...|...||....|.........|
  Rat   141 KINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFRSPSGPGKAV 205

  Fly   213 PTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLED---- 273
            ..|..:..:..:...|...:.:||.:.. .::|:.:||  ...|..:|.||   .|..|.|    
  Rat   206 NMMHQERRFNLSTIQEPPMQILELQYHG-GISMYIMLP--EDDLSEIESKL---SFQNLMDWTNS 264

  Fly   274 -RWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFSNIFQDSPIGTR--ITKVQHKT 334
             :.:.|.|:|:||:||.|.|.::|..|..:|:..:|.:: ||.|.|..    |.|  ::|:.||:
  Rat   265 RKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESRADLSGIAS----GGRLYVSKLMHKS 325

  Fly   335 FIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHI 387
            .|:|:|.|.||..|:.:..|...|| :...|.||.||.|:||....:.|||.:
  Rat   326 LIEVSEEGTEATAATESNIVEKLLP-ESTVFRADRPFLFVIRKNGIILFTGKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 113/376 (30%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 113/378 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.