DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and LOC100909605

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:367 Identity:111/367 - (30%)
Similarity:185/367 - (50%) Gaps:16/367 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG-LAESYH 93
            ||..|::.|.....|:|::.|..||..||.|...||:..|..|:.:.|..:..|:.:. :.:.|.
  Rat    44 FAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETPEAEIHQGYE 108

  Fly    94 NLLH--SYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVK 156
            :||.  :....:..:...:.::.:::|.:.:.|:|.|:..:.:|....||.:..||.:.||.:|:
  Rat   109 HLLQRLNLPGDQVQISTGSALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHEAKKLINDYVR 173

  Fly   157 QQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWY 221
            :||:.||:.::..|:..|::.|||.||||.:|..||:..||...||:|.|.:|::||.|..:...
  Rat   174 KQTQGKIKELISVLDKKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVKVPMMKIEKLT 238

  Fly   222 --YYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSV-SVY 283
              |:.| .||....:||.:.. |.:..||||:| ..:|.:|..|:.......:|..:.:.: .:.
  Rat   239 TPYFRD-EELSCSVLELKYTG-NASALFILPDQ-GRMQQVEASLQPETLRRWKDTLRPRRIDELR 300

  Fly   284 LPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGA 348
            :|||....|..|...|.::||..:||..||.|.|.....:.  :::|.||..:||.|.|.|||.|
  Rat   301 MPKFSISTDMRLGDILPELGIREVFSQQADLSRITGAKDLS--VSQVVHKAVLDVTETGTEAAAA 363

  Fly   349 SYAAGVPMSLPLDPKTFVADHPFAFIIRDKHAVYFTGHIVKF 390
            :....:||.......|...:.||..||.|.:.     ||..|
  Rat   364 TGVKIIPMCAKFYYVTMYFNRPFLMIISDTNT-----HIALF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 108/362 (30%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 111/367 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.