DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpina10

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_012824917.1 Gene:serpina10 / 100487295 XenbaseID:XB-GENE-983018 Length:437 Species:Xenopus tropicalis


Alignment Length:377 Identity:96/377 - (25%)
Similarity:186/377 - (49%) Gaps:38/377 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG---LAES 91
            |...|::.:| ::.|.|:..||.|:.|.|.....|..|.|..:|...|:.:..:.::.   |.|.
 Frog    76 FGFNLYRKIA-NKHDNNIFFSPFSVSLGLSSLLLGTRGNTYDQLLHGLNYNPFKDQENPYLLPEL 139

  Fly    92 YHNLLHSYIKS-KTVLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWV 155
            ...:.....|: :.||.|.:..:..:..::...|..:.:||||.|.|.:|| ..::|..:||.:|
 Frog   140 LKTIKEKIAKNEELVLNIGSLSFLHETFSMKDEFVNLTKKYFDMEYELIDF-HSSKAKNEINAYV 203

  Fly   156 KQQTENKIERVVESLEPDTNVALVNAIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNW 220
            ::.|:..|....:.::|.|.:.|::.|:||.:|..|||...|....|::.:..|:.||.|:..: 
 Frog   204 EKLTKGLISNFYDFIDPQTKLLLLDYIFFKGKWQYPFNPALTEVDSFFIDKYNSVTVPMMYKTD- 267

  Fly   221 YYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRW------QWQS 279
                       |...:|.::::.|: |.||.:.:....:.:..|..||.:|||..      .||:
 Frog   268 -----------KVASVFDKDLSCTV-FKLPYRGNAHMLIIKPEKEGDFGILEDHLTKELINSWQA 320

  Fly   280 ------VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDV 338
                  ..::.||||.:....|:.:|:::||..:|:..|:.:::.::..:  .:|::..:..|:|
 Frog   321 KMQSRKTDIFFPKFKLDQKYKLKSSLNELGIKELFTGKANLTDLTEERNL--MLTEITQQAMIEV 383

  Fly   339 NEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHIV 388
            :|.|.|||..:.|..:..||||   |...:.||.|:|.::  .::.|.|.::
 Frog   384 DERGTEAAAVAGAEIIAYSLPL---TIRVNRPFLFMIFEEAYQSLLFLGRVM 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 96/374 (26%)
serpina10XP_012824917.1 serpinA10_PZI 58..436 CDD:381011 96/377 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.