DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpine1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:397 Identity:109/397 - (27%)
Similarity:191/397 - (48%) Gaps:32/397 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSIILLGVWISAPEGLGNTIKDRNL-FATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGR 68
            ||::|  ::......|.|.|:|:.. |..::|........|.|:.:||..|...||:|..||.|.
Zfish     4 LSVLL--IFALCASSLCNLIQDKQTDFGLQVFAEAVQSAPDRNLALSPYGIASVLGMAQMGAYGA 66

  Fly    69 TAAELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTVSSHFREVAQKYFD 133
            |...|...:..|.:|.  |:.: ...||...:.|:..:|:|:.|...:.:.:...||....|.|.
Zfish    67 TLKLLASKMGYSLQER--GMPK-LQRLLQRDLASEDGVEVASGVMVDRKIILEKVFRRSLSKAFQ 128

  Fly   134 SEVEPLDFSRETEAVEQINRWVKQQTENKIERVVES--LEPDTNVALVNAIYFKARWARPFNDED 196
            |....:|||:...|.:.||.|....|:..|...:.|  |...|.:..:||::|...|..||:..:
Zfish   129 SVPHQIDFSQPEMARQVINSWTSDHTDGMISEFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRN 193

  Fly   197 TRDREFWLSESRSIQVPTMFADNWYYYADYPE---LDAKAIELFFENINLTMWFILPNQRS-GLQ 257
            ||::.|......::.||.|.....:.|.::..   :|...||:.:|..:::|..:.|.::. .|.
Zfish   194 TREQLFHTVNGSAVSVPMMTTTQKFNYGEFVSKDGVDYDVIEMPYEGESISMLLVTPFEKDVPLS 258

  Fly   258 ALEQKLKGVDFNLLEDRWQWQ------SVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDA-ADFS 315
            ||.::|.....:      ||:      |..:.:|:|..:.:.||:.||.:||:..:||.: ||||
Zfish   259 ALNKELSSSRIH------QWRQEMRKISKQLSIPRFSMDTEIDLKSTLSRMGLGDIFSQSRADFS 317

  Fly   316 NIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRDK-- 378
            .|..:.|:  .::||..:..::|||.|.:.:.|: ||.:...:.::..|.  |.||.|:|:.|  
Zfish   318 RITTEEPL--CVSKVLQRVKLEVNEEGTKGSSAT-AAVIYSRMAVEEITL--DRPFFFLIQHKPT 377

  Fly   379 HAVYFTG 385
            .|:.|:|
Zfish   378 GALLFSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 102/374 (27%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 101/371 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.