DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpine1

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_002941247.2 Gene:serpine1 / 100127732 XenbaseID:XB-GENE-969639 Length:403 Species:Xenopus tropicalis


Alignment Length:409 Identity:107/409 - (26%)
Similarity:196/409 - (47%) Gaps:42/409 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IILLGV--WISAPEGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRT 69
            ::||.:  ..||...:....:....|...|||.:..|:..:|:..||..:..||.:...||.|.|
 Frog    10 VVLLSLASVTSAQNRVSRVAQKGTSFGLRLFQEVLADQWGKNLGFSPYGVTSALSVLQSGAAGTT 74

  Fly    70 AAELQKTLHASAKESKDGLAESYHNLLHSYIKSK-------TVLEIANKVYTRQNLTVSSHFREV 127
            ..:::|.|:...||....||   .|.|...|..:       ..:.||:.::.:::|:::..|.:.
 Frog    75 LDQIRKALNYGHKEWAVALA---LNKLREQISGQQKSAEDPKPVHIADGLFVQRDLSLTPGFLQR 136

  Fly   128 AQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVES--LEPDTNVALVNAIYFKARWAR 190
            .|..|...:..::|:...:|.:.||:||:.:|:..|:.:|.|  :.|.|.:.|::|::|..:|..
 Frog   137 FQATFHRHLSQVNFTDVAQAKDIINQWVENKTDGMIKDLVGSNNIPPLTRLVLLSAVHFSGKWTV 201

  Fly   191 PFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDA---KAIELFFENINLTMWFILPNQ 252
            ||.::.|..|.|:.|:...:||..|.....|..:::...|.   ..|||.:|...|:|....|.:
 Frog   202 PFLEKATHQRPFYRSDGSHVQVQMMANTGKYNCSEFTTPDGDFYDVIELPYEGEELSMLIAAPYE 266

  Fly   253 RS-GLQALEQKLKGVDFNLLED----RWQWQSVSV----YLPKFKFEFDTDLRPTLHKMGISAMF 308
            :: .|.|:.        |:|..    :|:.|...|    .||||....:.||:..|.::||:.||
 Frog   267 KNVPLSAIT--------NILTPELIAQWKAQMKKVTRLLVLPKFSLLSEVDLKKPLERLGITDMF 323

  Fly   309 S-DAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFA 372
            : :.||||.:..:.|:  .:::...|..::|.|.|..|:.|:.|..:....||:   .:.||||.
 Frog   324 TQETADFSRLSSEKPL--YVSEAFQKIKVEVTEKGTRASAATAAILLARMAPLE---VIMDHPFL 383

  Fly   373 FIIRDK--HAVYFTGHIVK 389
            |::|..  ..:.|.|.:::
 Frog   384 FMVRHNPTGTLLFVGQVME 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 103/382 (27%)
serpine1XP_002941247.2 SERPIN 22..403 CDD:294093 103/397 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.