DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Aa and serpina10b

DIOPT Version :9

Sequence 1:NP_524805.1 Gene:Spn43Aa / 45041 FlyBaseID:FBgn0024294 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:401 Identity:107/401 - (26%)
Similarity:201/401 - (50%) Gaps:36/401 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGVWISA-------------PEGLGNTIKD---RNL-FATELFQTLATDRQDENVIISPVSIQL 56
            ||.|:|||             |:     |.|   ||. ||..|::.::: ..|.||:.||:|:..
Zfish     5 LLLVFISACFLCSAEHEELRTPD-----ISDLAFRNTDFAINLYRKISS-LHDRNVVFSPLSVST 63

  Fly    57 ALGLAYYGAEGRTAAELQKTLHASAKESKDG--LAESYHNLLHSYIKSKTVLEIANKVYTRQNLT 119
            ........|:|.|..|:.|.|:..|.:..|.  :.|.:.. ||..|..:  :|....::..|:..
Zfish    64 CFSALLLAAQGSTRTEILKGLNLEALDGGDSRRVPELFQQ-LHQNISLQ--MEQGTALFLDQHFH 125

  Fly   120 VSSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVNAIYF 184
            :.::|.:..|::|::||..:|||:.......||.:|.::|..|:..::||:||.|.:.|:|.|::
Zfish   126 LQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLINEFVSRKTGRKVLEMLESVEPLTQMLLLNTIFY 190

  Fly   185 KARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFIL 249
            |..|.||||..:|....|::.:...:|||.|..:..:...:..:|.|:.:.|.:.. ..:|..:|
Zfish   191 KGDWERPFNPNNTEKSRFYVDKYNIVQVPMMMLEEKFSVVEDRDLRARVLRLPYRG-GASMLILL 254

  Fly   250 PNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADF 314
            |:..:...|:|.::.....:......:...:.|:||:|:.:....:...|.::|||::|.|:||.
Zfish   255 PSADADYTAIEDEISAERLHGWIKNMRRMKMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADL 319

  Fly   315 SNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFII--RD 377
            :.:.:|:.:  ::::|.||..|:|.|.|..||.::.......||   |.||:.:.||.|.:  .:
Zfish   320 TGLSRDAHL--KVSQVLHKAVIEVYEQGTSAASSTSVGITAYSL---PDTFIINRPFFFFLYHEE 379

  Fly   378 KHAVYFTGHIV 388
            ..::.|.|.::
Zfish   380 TASLLFMGRVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AaNP_524805.1 SERPIN 28..387 CDD:238101 97/363 (27%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 97/366 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.