DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINB11

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:391 Identity:101/391 - (25%)
Similarity:193/391 - (49%) Gaps:49/391 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLR-------LGPGDADAV--- 89
            |::..:.::::.:|:..|..::..::::..:||:|:|..:|::.|.       |.||..|:.   
Human    14 DVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKPGFKDSPKCS 78

  Fly    90 ------SQRSGSYQQALTRDNN--FRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYN 146
                  |:....:.|....|:|  ..:||.:|..:.:.|...:...:::.:.:.:..:||... .
Human    79 QAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDFEQS-T 142

  Fly   147 KRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSG 211
            :.|...||..|..|||||:.::.....::..:..|:||.:.:...||..|::.:|.|..|:...|
Human   143 EETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVKSPFQLSEG 207

  Fly   212 QSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSL--------- 267
            ::|.|:.|:.:..|..|.|.....:|:||||.|...||::|||.....|:.:::.|         
Human   208 KNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSGTFHEWT 272

  Fly   268 SGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSR-DGDFGNM---YRMFVSH 328
            |..|       |.:::|||.||:|.:.....|....|.|||..:|:: ..|...|   ..:::|.
Human   273 SSSN-------MMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLSK 330

  Fly   329 FINAVEHKANVEVTEAGVDQPLETG---LLKGLFSRSKKFEADHPFVFAIK--YKDSIAFIGHIA 388
            .|    ||:.::|:|.|.:....||   .:|.|..|: :|:|:|||:|.|:  :.::|.|.|.:|
Human   331 AI----HKSYLDVSEEGTEAAAATGDSIAVKSLPMRA-QFKANHPFLFFIRHTHTNTILFCGKLA 390

  Fly   389 N 389
            :
Human   391 S 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 100/387 (26%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 101/391 (26%)
RCL. /evidence=ECO:0000250 341..365 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.