DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpind1

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:388 Identity:98/388 - (25%)
Similarity:177/388 - (45%) Gaps:43/388 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLL----AADLYNAVAADHL--NENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADA 88
            |:|    |.:||. |..|..  ::|:.|:|..|.::|.:..:|.:|:|..|:...|..    .|.
  Rat   107 NILNAKFAFNLYR-VLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHF----KDF 166

  Fly    89 VSQRSGSYQQALTRDNNFR----------------LANNIYINENLEFKGSFRDVAQRQFDSNID 137
            |:  :.|..:..|..|.||                ..|::||.:....:..|:...:..:.:...
  Rat   167 VN--ASSKYEVTTIHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQ 229

  Fly   138 KLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTE 202
            :.||..|.....|   |..:...|.|.|.:.|  |..:..|:.:|:|.:.:..||...|.::.|.
  Rat   230 EADFSDPAFISKA---NSHILKLTKGLIKEAL--ENTDSATQMMILNCIYFKGAWMNKFPVEMTH 289

  Fly   203 KRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSL 267
            ..:||....:.|||..|.|..||..|....||..:::|.|.. ..|||:::|.:..|:::|:..|
  Rat   290 NHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVG-GISMLIVIPRKLSGMKTLEAQL 353

  Fly   268 SGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNM--YRMFVSHFI 330
            :.:.:.....:|:.:..|||||||.:.....|....|.:|:..:|:::|:...:  .|:.:..| 
  Rat   354 TPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGISDQRIIIDLF- 417

  Fly   331 NAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAI-KYKDS-IAFIGHIANYA 391
               :|::.:.|.|.|......|.:.....|...:|..|.||:|.: :::.| :.|:|.:||.|
  Rat   418 ---KHQSTITVNEEGTQAAAVTTVGFMPLSTQVRFTVDRPFLFLVYEHRTSCLLFMGRVANPA 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 95/382 (25%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 97/386 (25%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.