DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpine3

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:385 Identity:92/385 - (23%)
Similarity:164/385 - (42%) Gaps:46/385 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQ 97
            |..||.:.||:....|.|||||::..|:.:....|:|.|..:|.:.|.....|...   |...:.
  Rat    36 ALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQDPRV---REFLHT 97

  Fly    98 QALTRDNN-----FRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAV 157
            ..:|..|:     ..||..:::.........|.:...|..:|:::..||..| |..|.:......
  Rat    98 VYITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEP-NTTTMEASKGTT 161

  Fly   158 ATKTNGKITDIL--RAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMW 220
            ...|.......|  ||..|:  |:..||:.:::.::||:.|.....:...|....|..::|..|.
  Rat   162 RPSTGEGPGSPLWGRAGALS--TQLSIVSTMTFQSSWQQRFSSVALQPLPFTCAHGLVLQVPAMH 224

  Fly   221 TLQNFNYAEVNSLDA-----KVVELPYQNPDFSMLLLLPNRK-DGLRSLQQSLSGKNLLAEIGAM 279
            .:...:|.:..  ||     .|:||.|.....|:||:||..| ..|..::..|:.:.:......:
  Rat   225 QVAEVSYGQFQ--DAAGHKVDVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTARVIHLWTTRL 287

  Fly   280 SQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMF-----------SRDGDFGNMYRMFVSHFINAV 333
            .:.:::|.||:|.:.....|:...:..|:..:|           .|||           .:::.|
  Rat   288 KRARMDVFLPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGISGRDG-----------FYVSEV 341

  Fly   334 EHKANVEVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAIKYKDSIAF---IGHIANY 390
            .|||.:|::|.|......|.:|....||:..|:||.||:|.::..:::|.   .|.:||:
  Rat   342 THKAKMELSEEGTKSCAATAVLLLRRSRTPAFKADRPFIFLLREHNTVAVRITHGKVANF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 90/380 (24%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 90/382 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.