DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpina12

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:360 Identity:79/360 - (21%)
Similarity:168/360 - (46%) Gaps:18/360 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGL---RLGPGDADAVSQRSGSYQ 97
            |...:|::....|:.:||.:|.::.::..:||:..|..|:::|.   .:...|..|.........
Mouse    59 LLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWDVHAAFHYLLHKL 123

  Fly    98 QALTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTN 162
            ...|.|....|.|.:::::.|..:..|.::|:..:|:::...:|....|  |...|||.::.||:
Mouse   124 NQETEDTKMNLGNALFMDQKLRPQQRFLNLAKNVYDADMVLTNFQDLEN--TQKDINRYISQKTH 186

  Fly   163 GKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNY 227
            .:|.:::::  ::..|..::.|.:.:...||..|...:|::..|....|::|||..|:....::.
Mouse   187 SRIKNMVKS--IDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRGLYDM 249

  Fly   228 AEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFS 292
            |..:.|...::|:||:....:..:|..|.|  |:.|:|.|...........:|::.|:|.:||..
Mouse   250 AYDSQLSCTILEIPYRGNITATFVLPDNGK--LKLLEQGLQADIFAKWKSLLSKRVVDVWVPKLR 312

  Fly   293 VTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSH---FINAVEHKANVEVTEAGVDQPLETGL 354
            ::....::....:||:..:|..:||...:    .||   .:....|||.:::.|.|::....:|.
Mouse   313 ISSTYNMKKVLSRLGISKIFEENGDLTRI----SSHRSLKVGEAVHKAELKMDEKGMEGAAGSGA 373

  Fly   355 LKGLFSRSKKFEADHPFVFAI--KYKDSIAFIGHI 387
            ........:..:.|.||:..|  .:..|:.|:..|
Mouse   374 QTLPMETPRHMKLDRPFLMMIYENFMPSMVFLARI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 78/358 (22%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 78/358 (22%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.