DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb11

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_080143.1 Gene:Serpinb11 / 66957 MGIID:1914207 Length:388 Species:Mus musculus


Alignment Length:377 Identity:96/377 - (25%)
Similarity:182/377 - (48%) Gaps:25/377 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLG--PGDADAVSQRSGSYQ 97
            |::..::::::.||:..||.|...::::..:|.:|::|.::::.|...  .|...|.::.|....
Mouse    14 DVFKELSSNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGVLKAKTKNSSECS 78

  Fly    98 QA-------------LTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRT 149
            |.             :.:.|:..:||.||...::.|...:....::.:.:.:..:||... .:.|
Mouse    79 QVGVMHPDFRALISHINQQNSLSVANRIYGTRSISFHKQYVRCCEKLYQAKLQTVDFELS-TEET 142

  Fly   150 ADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSV 214
            ...||..|..|||||||::.....::..:..|:|:.:.:...||..|:..:|.|..|..|.|:|.
Mouse   143 RKSINAWVKNKTNGKITNLFAKGTIDPSSVMVLVSAIYFKGQWQNKFQKRETVKAPFHMGVGKSA 207

  Fly   215 KVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNL--LAEIG 277
            .|:.|:....|..|.:...:.:|:||||.|....|::|||.....:..:::.|:.|.|  .....
Mouse   208 VVNMMYQTGTFKLAIIKEPEMQVLELPYANNKLRMIILLPVGTASVSQIEKHLNVKMLREWTNPS 272

  Fly   278 AMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFS-RDGDFGNMYRMFVSHFINAVEHKANVEV 341
            .|.:::|:|.:||||::....|....|.||:..:|: .:.|...| ......:::.|.||:.|:|
Mouse   273 NMVEREVDVHIPKFSLSVKYDLNTLLKSLGMRDIFNVANADLSGM-SPDKGLYLSKVVHKSYVDV 336

  Fly   342 TEAGVDQPLETG---LLKGLFSRSKKFEADHPFVFAI-KYKDSIAFIGHIAN 389
            .|.|.:....||   .:|.| ..:.:|.|:.||:|.| ....:|.|.|..|:
Mouse   337 NEEGTEAAAATGESISVKRL-PVTVQFTANCPFLFFIWDESGNILFAGKFAS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 95/373 (25%)
Serpinb11NP_080143.1 SERPIN 4..388 CDD:294093 96/377 (25%)
RCL. /evidence=ECO:0000250 338..362 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.