DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpina5

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:411 Identity:101/411 - (24%)
Similarity:187/411 - (45%) Gaps:41/411 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISCLLLLLA--------------TVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPAT 55
            |.||:|..:              ..|:..:||....:.....|..||.|:|::...:||..||.:
  Rat    42 ILCLVLFFSHGVASRQRSHSKEKKKSKESSVGAVGTSRSRDFAFRLYRALASEAPGQNVFFSPMS 106

  Fly    56 IQSSMALAFVGAKGQTASELQQGLRLG--PGDADAVSQRSGSYQQALTRDN------NFRLANNI 112
            :..|:.:..:|:..:|.:::.:||.|.  .|..|.:.:   .:||.|.:.:      ...|.:.:
  Rat   107 VSMSLGMLSLGSGLKTKAQILEGLGLSLQQGQEDMLHK---GFQQLLQQFSQPSDGLQLSLGSAL 168

  Fly   113 YINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDR 177
            :.:..:..:..|....:..:.|::...:|..|.:.:..  ||..||.||||||.|:::.  |:..
  Rat   169 FTDPAVHIRDHFLSAMKTLYMSDMFSTNFGNPESAKKQ--INDYVAKKTNGKIVDLIKD--LDST 229

  Fly   178 TEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPY 242
            ...|:||.:.:.|.||.||....|.|..:.....::::|..|.....::|....::...||.:||
  Rat   230 HVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKKTIQVPMMNREDIYSYILDQNISCTVVGIPY 294

  Fly   243 QNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLG 307
            |...|::.:|....|  ::.::..|..:.|...:...:::::::.|||||:.....||....|||
  Rat   295 QGNTFALFILPSEGK--MKRVEDGLDERTLRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLG 357

  Fly   308 VHTMFSRDGDFGNMYRMFVSHF---INAVEHKANVEVTEAGVDQPLETGLLKGLFS---RSKKFE 366
            :..:|:...|...:    ..|.   ::.:.||:.|||.|:|......||:|..|.|   .|.|.|
  Rat   358 IQDIFTTHADLSGL----TDHTNIKLSEMVHKSMVEVDESGTTAAASTGILFTLRSARPSSLKVE 418

  Fly   367 ADHPFVFAIKYKDSIAFIGHI 387
            ...||:..|....::.|||.:
  Rat   419 FTRPFLVVIMDGTNLYFIGKV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 94/370 (25%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 94/370 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.