DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINB4

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_002965.1 Gene:SERPINB4 / 6318 HGNCID:10570 Length:390 Species:Homo sapiens


Alignment Length:387 Identity:106/387 - (27%)
Similarity:191/387 - (49%) Gaps:43/387 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQ-------- 91
            ||:........| |:..||.:|.|::.:..:|||..||.::.:.|..     |.|::        
Human    14 DLFQQFRKSKEN-NIFYSPISITSALGMVLLGAKDNTAQQISKVLHF-----DQVTENTTEKAAT 72

  Fly    92 ----RSGS----YQQALTRDN------NFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDF- 141
                |||:    :|:.||..|      ..::||.::..:..:|...:.|..::.:.::::..|| 
Human    73 YHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYLDAIKKFYQTSVESTDFA 137

  Fly   142 HPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSF 206
            :.|...|..  ||..|.::||.||.::.....:.:.|..|:||.:.:...|:..|:.:.|::..|
Human   138 NAPEESRKK--INSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKF 200

  Fly   207 RTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKN 271
            .........|..|....:||:|.:..:.|||:|:||:..|.||::||||..|||:.|::.|:.:.
Human   201 WPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEK 265

  Fly   272 LL--AEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSH--FINA 332
            |:  ..:..|.:..|::.||:|.:.....|:...:.:|:..:|:.|.|...   |..||  .::.
Human   266 LMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLRTMGMVNIFNGDADLSG---MTWSHGLSVSK 327

  Fly   333 VEHKANVEVTEAGVDQPLETGLL---KGLFSRSKKFEADHPFVFAIKYK--DSIAFIGHIAN 389
            |.|||.|||||.||:....|.::   ....|.:::|..:|||:|.|:..  :||.|.|..::
Human   328 VLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 106/383 (28%)
SERPINB4NP_002965.1 SERPIN 4..390 CDD:320777 106/387 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.