DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb2

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_067728.1 Gene:Serpinb2 / 60325 RGDID:621823 Length:416 Species:Rattus norvegicus


Alignment Length:411 Identity:103/411 - (25%)
Similarity:183/411 - (44%) Gaps:57/411 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLR--------LGPGDAD 87
            :.|.:|...:...:..:|:.|||.:|.|::|:.|:||:..|..::.:.|.        |.||:.:
  Rat    10 MFALNLLKQIEQSNSTQNIFISPWSISSTLAIVFLGAQANTEEQMAKVLNFDKIGSYDLTPGNPE 74

  Fly    88 AVS--------QRSG---SYQQALTRD-------------NNFRL-------ANNIYINENLEFK 121
            ...        ||..   :..||..||             |..||       ||.::..::..||
  Rat    75 NFHGCDFAQHIQRDNYPVAILQAQARDKIHSAFSSLSSTINTPRLGDYLLESANKLFGEKSARFK 139

  Fly   122 GSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGV 186
            ..:....::.:.:..:.:||....|: ....||..|.|:|.|:|.::|....:::.|:.|:||.:
  Rat   140 EEYIQRCKKYYSTEPEAVDFLECANE-ARKKINSWVKTQTKGEIPNLLPEGSVDEDTKMVLVNTI 203

  Fly   187 SYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLL 251
            .:...|:..|:........||....:|..|..|:..:..|...:..|..:::||||.. :.||.|
  Rat   204 YFKGRWKTPFQKRLNGLYPFRVNLNESKPVQMMYLREKLNIGYIKDLKTQILELPYIG-NISMFL 267

  Fly   252 LLPNR----KDGLRSLQQSLSGKNLLAEIG--AMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHT 310
            |||:.    ..||..|::.::..|....|.  .:.:..|.|.:|||.:.....|:...:::|:..
  Rat   268 LLPDEIEDSSTGLEMLEREINFDNFNKWISKETLDEDDVLVYIPKFKLAQNYELKPILQRMGMED 332

  Fly   311 MFSR-DGDFGNMYRMFVSH--FINAVEHKANVEVTEAGVDQPLETG-LLKGLFSR-SKKFEADHP 370
            .|:: ..||..|..   |:  |::.|.|:|.|:|.|.|......|| ::.|.... ..:|.||||
  Rat   333 AFNKGKADFSGMSE---SNDLFLSEVFHQATVDVNEEGTVAAGGTGAVMTGRTGHGGPQFVADHP 394

  Fly   371 FVFAI--KYKDSIAFIGHIAN 389
            |:|.|  ....:|.|:|..::
  Rat   395 FLFFIMNNITRTILFVGRFSS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 103/407 (25%)
Serpinb2NP_067728.1 serpinB2_PAI-2 2..416 CDD:381029 103/411 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.