DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and serpinb1l2

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:391 Identity:113/391 - (28%)
Similarity:188/391 - (48%) Gaps:58/391 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSG 94
            :|.|.|||.|::|.....|:..||.:|.:::::.::||:|.||.|:::.|..     .:||....
Zfish     9 SLFALDLYRALSASSAEGNIFFSPLSISAALSMVYLGARGDTAGEMEKVLCF-----SSVSDFHA 68

  Fly    95 SYQQALTRDNN------FRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADG- 152
            .::..::..|:      .||||.:|..:...|...:.|...:.:.:....:||     .|.||. 
Zfish    69 HFKTLISSINSPSASYILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVDF-----IRAADDS 128

  Fly   153 ---INRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSV 214
               ||:.|..:|..:|.|:|:..::|:.|..::||.:.:...|...|....|::..|:....:|.
Zfish   129 RQFINKWVEKQTENQIKDLLQPGVVNEMTRLLLVNAIYFKGNWMHTFDAHATKEMPFKINQNESR 193

  Fly   215 KVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNR----KDGLRSLQQSLSGKNLL-- 273
            .|..|..::||.|..:.....:|:||||...:.|||:|||:.    .|.|..|:..|:.:.||  
Zfish   194 PVQMMDQVENFPYRCIPEYKLQVLELPYTQQELSMLILLPDEIKYGSDPLLKLESELNLQKLLDW 258

  Fly   274 AEIGAM-SQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMF----------SRDGDFGNMYRMFVS 327
            ...|.| :.:|:.|.||||.:.....|....:|:|:.::|          |.:|..         
Zfish   259 TSRGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMSSNGGL--------- 314

  Fly   328 HFINAVEHKANVEVTEAGVDQPLETGLL------KGLFSRSKKFEADHPFVFAIKYK--DSIAFI 384
             |::||.|||.|||.|.|.:....|.||      :|.|   ..|.|||||:|.|::.  :||.|:
Zfish   315 -FLSAVIHKAFVEVNEEGTEAAAATALLLPISACQGAF---HDFIADHPFMFFIRHNPTNSILFL 375

  Fly   385 G 385
            |
Zfish   376 G 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 113/391 (29%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 113/391 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.