DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINB9

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:387 Identity:107/387 - (27%)
Similarity:182/387 - (47%) Gaps:53/387 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQ 97
            |..|...:..|:.:.||..||.:|.|::|:..:||||.||:::.|.|.|     :.......::|
Human    12 AIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL-----NTEEDIHRAFQ 71

  Fly    98 QALTRDNN------FRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTAD----G 152
            ..||..|.      .|.||.::..:..:|..:|::...:.:.:.:.:|.|     .|.|:    .
Human    72 SLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSF-----IRAAEESRKH 131

  Fly   153 INRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVD 217
            ||..|:.||.|||.::|....::..|..|:||.:.:...|.:.|....|.:..|:....:...|.
Human   132 INTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQ 196

  Fly   218 TMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLA--EIGAMS 280
            .|:....|..|.|..:.|:::||||...:.|:|:|||:....|.::::||:.:.|.|  :...|.
Human   197 MMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMK 261

  Fly   281 QQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSR-DGDFGNMYR---MFVSHFINAVEHKANVEV 341
            ..:||||||||.:.....:|...:.||:...|.: ..|...|..   :.:|.|:    ||:.|||
Human   262 STEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFV----HKSFVEV 322

  Fly   342 TEAGVDQP------------LETGLLKGLFSRSKKFEADHPFVFAIKYK--DSIAFIGHIAN 389
            .|.|.:..            :|:|         .:|.|||||:|.|::.  :||.|.|..::
Human   323 NEEGTEAAAASSCFVVAECCMESG---------PRFCADHPFLFFIRHNRANSILFCGRFSS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 107/383 (28%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 107/387 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.