DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINF1

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:375 Identity:77/375 - (20%)
Similarity:155/375 - (41%) Gaps:31/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLLAA-------DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDAD 87
            |.|||       |||...::.....||::||.::.::::...:||:.:|.|.:.:.|..     |
Human    52 NKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYY-----D 111

  Fly    88 AVSQRS--GSYQQAL----TRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYN 146
            .:|...  |:|::.|    ....|.:.|:.|...:.|..|.||....::.:.:....|..:|   
Human   112 LISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNP--- 173

  Fly   147 KRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSG 211
            :.....||..|..:..||:....:.  :.|....:::....:...|...|...||....|.....
Human   174 RLDLQEINNWVQAQMKGKLARSTKE--IPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEE 236

  Fly   212 QSVKVDTMWTLQN-FNYAEVNSLDAKVVELPYQNPDFSMLLLLPNR-KDGLRSLQQSLSGKNLLA 274
            ::|:|..|...:. ..|...:.|..|:.:||... ..|::..||.: ...|..:::||:.:.:..
Human   237 RTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTG-SMSIIFFLPLKVTQNLTLIEESLTSEFIHD 300

  Fly   275 EIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSHFINAVEHKANV 339
            ....:...:..:.:||..:::...:....:::.:.::|. ..||..:....:.  :..|||:|..
Human   301 IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFD-SPDFSKITGKPIK--LTQVEHRAGF 362

  Fly   340 EVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAIKYKD--SIAFIGHI 387
            |..|.|.......||.....:....:..:.||:|.::..|  ::.|||.|
Human   363 EWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 76/373 (20%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 77/375 (21%)
O-glycosylated at one site 371..383 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.