DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINA5

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:379 Identity:99/379 - (26%)
Similarity:178/379 - (46%) Gaps:32/379 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AAADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAV 89
            |.:.|.....|||.|:|:...::::..||.:|..|:|:..:||...|..::.:||.|....:...
Human    41 APSSRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEK 105

  Fly    90 SQRSGSYQQALTRDNNFR------LANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKR 148
            ....| :||.|...|..|      |.|.::.:..::.:.:|....:..:.::..      |.|.|
Human   106 ELHRG-FQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTF------PTNFR 163

  Fly   149 TADG----INRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTG 209
            .:.|    ||..||.:|.|||.|:|:.  |:.....::||.:.:.|.|:.:|....|:::.|...
Human   164 DSAGAMKQINDYVAKQTKGKIVDLLKN--LDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVT 226

  Fly   210 SGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLA 274
            |...|:|..|.....::|....:|..:||.:|||. :.:.|.:||: :..::.::..||.|.|..
Human   227 SETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQG-NATALFILPS-EGKMQQVENGLSEKTLRK 289

  Fly   275 EIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGD---FGNMYRMFVSHFINAVEHK 336
            .:....::::|:.|||||:.....||.....||:..:|:...|   ..|...:.||..:    ||
Human   290 WLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMV----HK 350

  Fly   337 ANVEVTEAGVDQPLETGLL---KGLFSRSKKFEADHPFVFAIKYKDSIAFIGHI 387
            |.|||.|:|......||.:   :.....|::...:.||:..| ..::|.|:|.:
Human   351 AVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFI-VDNNILFLGKV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 97/372 (26%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 98/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.