DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and serpinb5

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001011282.1 Gene:serpinb5 / 496735 XenbaseID:XB-GENE-5802997 Length:379 Species:Xenopus tropicalis


Alignment Length:367 Identity:100/367 - (27%)
Similarity:175/367 - (47%) Gaps:24/367 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGP-GDADAVSQRSGS 95
            ||.|::..:......:|.|.||..|.||::|...|::|.|||||::.|.... .|.|...|...|
 Frog    11 LAVDIFKKLCEKSATDNFVCSPLCISSSLSLIRKGSQGNTASELEKALHFEKVKDPDFGFQLLSS 75

  Fly    96 YQQALTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNK-RTADGINRAVAT 159
            ....::..|:.:|...:|::.::|.|..|.:.|::.:...::.:||.....: ||.  ||.:|..
 Frog    76 DISKISSANSLKLLKRVYVDNSIECKKDFINSAKKPYPLELETIDFKSQAEEARTQ--INSSVKE 138

  Fly   160 KTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQN 224
            .|:|....:|.....::.|:.:::...|:...|...|...:|::..|.....::..|..|.....
 Frog   139 LTDGNFETVLNEGSCDENTKIIMLGAASFKGKWVYTFNKSETKEMDFHINKKETKPVQMMHLEAR 203

  Fly   225 FNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKD------GLRSLQQSLSGKNLL--AEIGAMSQ 281
            .:...:|.|...|:|:|:|:..||||:|||  ||      ||:.|:|.::.:...  .....|:.
 Frog   204 LSIGYINELKTMVLEMPFQSKHFSMLILLP--KDIEDDSTGLKKLEQDMTFEKYTHWTNPSMMAN 266

  Fly   282 QKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRD-GDFGNMYRMFVSHFINAVEHKANVEVTEAG 345
            .||:|.||||.:.....|:...|.||::..|:.: .||..|..........|:: ||.:||.|.|
 Frog   267 SKVKVSLPKFKMENSYDLKDMLKSLGINDAFNEEASDFSEMTESKGISISQAIQ-KACIEVDEDG 330

  Fly   346 ---VDQPLETGLLKGLFSRSKKFEADHPFVFAIKYKDSIAFI 384
               .|..:|..|:     ..::|.|||||::.:::..:...|
 Frog   331 TESADVSMERRLM-----NKEEFLADHPFIYILRHNKTRTII 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 100/367 (27%)
serpinb5NP_001011282.1 serpinB5_maspin 1..375 CDD:381013 100/367 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.