DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINC1

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens


Alignment Length:420 Identity:92/420 - (21%)
Similarity:184/420 - (43%) Gaps:99/420 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGS-------------YQ 97
            |:|:.:||.:|.::.|:..:||...|..:|.:..:.     |.:|:::..             |:
Human   105 NDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKF-----DTISEKTSDQIHFFFAKLNCRLYR 164

  Fly    98 QALTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTAD----GINRAVA 158
            :| .:.:....||.::.:::|.|..:::|:::..:.:.:..|||     |..|:    .||:.|:
Human   165 KA-NKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDF-----KENAEQSRAAINKWVS 223

  Fly   159 TKTNGKITDILRAELLNDRTEGVIVNGVSY----------------------------------- 188
            .||.|:|||::.:|.:|:.|..|:||.:.:                                   
Human   224 NKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERAN 288

  Fly   189 ------SAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDF 247
                  ...|:..|..:.|.|..|....|:|.....|:....|.|..| :...:|:|||::..|.
Human   289 GLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRV-AEGTQVLELPFKGDDI 352

  Fly   248 SMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMF 312
            :|:|:||..:..|..:::.|:.:.|...:..:.:..:.|.:|:|.:..|..|:...:.:|:..:|
Human   353 TMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLF 417

  Fly   313 S-------------RDGDFGNMYRMFVSHFINAVEHKANVEVTEAGVDQPLETGLL---KGLFSR 361
            |             ||    ::|       ::...|||.:||.|.|.:....|.::   :.|...
Human   418 SPEKSKLPGIVAEGRD----DLY-------VSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPN 471

  Fly   362 SKKFEADHPFVFAIKY--KDSIAFIGHIAN 389
            ...|:|:.||:..|:.  .::|.|:|.:||
Human   472 RVTFKANRPFLVFIREVPLNTIIFMGRVAN 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 90/416 (22%)
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 92/420 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.