DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Spn77Bb

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_649206.1 Gene:Spn77Bb / 40235 FlyBaseID:FBgn0036969 Length:362 Species:Drosophila melanogaster


Alignment Length:375 Identity:91/375 - (24%)
Similarity:143/375 - (38%) Gaps:108/375 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YNAVAADH-LNENVVISPATIQSSMALAF---VG----AKGQTASELQQGLRLGPGDADAVSQRS 93
            |..|.|.| ||     |..|...|:..|:   ||    .||..:..|:     |.|:.:.|    
  Fly    46 YEDVRAYHYLN-----SENTKLFSLRYAYYDDVGDLELVKGYNSVVLE-----GVGEGNVV---- 96

  Fly    94 GSYQQALTRDNNFRLANNIYINENLEFKGS----FRDVAQRQFDSNIDKLDFHPPYNKRTADGIN 154
              .::...|..:|....:|.||:::: |.|    |...::|.|:|.:            |..||.
  Fly    97 --LREGRPRGVDFDQGASIIINDDID-KASHAKIFSSYSRRSFNSTV------------TVLGIT 146

  Fly   155 RAVATKTNGKITDILRAELLNDRTEGVIVNGVSY-SAAWQKAFRLDKTEKRSF-RTGSGQSVKVD 217
                                           ||| .|.|:..|...:|:...| ..|...:.||:
  Fly   147 -------------------------------VSYFKAKWKYPFDKSQTKVEQFYNDGGSPAGKVE 180

  Fly   218 TMWTLQNFNYAEVNS---LDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKN-----LLA 274
            .|  :|...||.||:   |.|.|:|||:...:..|::|||....|:..:...|  ||     ||.
  Fly   181 MM--VQTGKYAYVNNVKGLQADVLELPFGEHELVMIVLLPKSSQGVNLVLYQL--KNLGLHRLLE 241

  Fly   275 EIGA-MSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSHFINAVEHK-- 336
            ::.| .::..|||.||||.....|.||......|:..:   ..||.::.::.:     |:.|:  
  Fly   242 KLEASKNETDVEVKLPKFDTRSVLSLEDTVYDAGLTDL---RNDFADLDKLLI-----AIGHRGA 298

  Fly   337 --------ANVEVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAIKYK 378
                    |.:.|.|.|:...:..   |.....:.||..:.||.:.:..|
  Fly   299 CLTLYHQFARIVVDEEGLPNAVPQ---KSSGKNNIKFHVNRPFAYLVLQK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 91/375 (24%)
Spn77BbNP_649206.1 SERPIN 13..356 CDD:238101 91/375 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.